- Recombinant Aquifex aeolicus Uncharacterized protein aq_aa19 (aq_aa19)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1154759
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 13,218 Da
- E Coli or Yeast
- 1-112
- Uncharacterized protein aq_aa19 (aq_aa19)
Sequence
MERIRMKTLEKSLEDSLKIYVSEALYTDIEDFKVDYPTALDFELTQVLLIREDLAKNKENIPQQLLDEIRQADKRYLDLYEQVKDLKTKNPHIQVAIKVLKALVELIKTEPI